Parathyroid Hormone (PTH) (5-34), human

Product Number: 231-51

$194.00$294.00

$194.00
$294.00
SKU: 231-51 Category: Tag:

Molecular Weight: 3712.99
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Sequence (1-letter): IQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH
Storage: -20 °C or below

Parathyroid Hormone (PTH) (5-34) is a N-terminal truncated form of the full length PTH. PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top