Urodilatin

Product Number: 151-30

$266.00$416.00

$266.00
$416.00
SKU: 151-30 Category: Tag:

CAS Number: 115966-23-9
Molecular Weight: 3505.7
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Sequence (1-letter): TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH
Storage: -20 °C or below

Urodilatin is a cardiovascular hormone which causes sodium excretion in urine (natriuresis) by increasing renal blood flow. It is secreted in the kidney in response to increasing mean arterial pressure.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top