CAS Number: 115966-23-9
Molecular Weight: 3505.7
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Sequence (1-letter): TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH
Storage: -20 °C or below
Urodilatin is a cardiovascular hormone which causes sodium excretion in urine (natriuresis) by increasing renal blood flow. It is secreted in the kidney in response to increasing mean arterial pressure.
![Angiotensin III, human / Angiotensin II-[Des Asp1], CAS 13602-53-4 - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/131-76.jpg)
