Urodilatin

Product Number: 151-30

$205
$394

CAS Number: 115966-23-9
Molecular Weight: 3505.7
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Sequence (1-letter): TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH
Storage: -20 °C or below

Urodilatin is a cardiovascular hormone which causes sodium excretion in urine (natriuresis) by increasing renal blood flow. It is secreted in the kidney in response to increasing mean arterial pressure.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders