Glucagon-like Peptide-1, human

Product Number: 471-26

$266.00$416.00

$266.00
$416.00

CAS Number: 87805-34-3
Molecular Weight: 4167.03
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Sequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
Storage: -20 °C or below
Solubility: water to 5 mg/mL

Glucagon-like peptide-1 (GLP-1) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat # 471-39 and 471-28, respectively) which are produced as a result of selective cleavage of proglucagon.

References

1. Baggio, L.L. and Drucker, D.J. (2007) “Biology of Incretins: GLP-1 and GIP” Gastroenterology 132 (6): 2131-57.
2. Kastin, A.J., Akerstrom, V. and Pan, W. (2002) “Interactions of glucagon-like peptide-1 (GLP-1) with the blood-brain barrier” J. Mol. Neurosci. 18 (1-2): 7-14.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top