Glucagon-like Peptide-1 (GLP-1) (7-37), human

Product Number: 471-39

$195.00$347.00

$195.00
$347.00

CAS Number: 106612-94-6
Molecular Weight: 3355.73
Salt Form: Acetate
Purity: >96%
Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Sequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
Storage: -20 °C or below

Glucagon-like Peptide-1 (7-37) is one the two primary biologically active forms of secreted glucagon-like peptide-1 (GLP-1). GLP-1 is secreted as a pro-pepetide that is then proteolytically cleaved into two active forms, (7-37) and (7-36). These active peptides can promote insulin secretion in a glucose-dependent manner.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top