CAS Number: 88813-36-9
Molecular Weight: 3208.63
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2
Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
Storage: -20 °C or below
Galanin is a neuropeptide first isolated from the porcine small intestine. It has a variety of biologic effects in the digestive system via the GAL1-3 receptors, including inhibiting the secretion of somatostatin, insulin, and glucose.

