Exendin 3

Product Number: 507-79

$293
$459

CAS Number: 130357-25-4
Molecular Weight: 4200.03
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence (1-letter): HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage: -20 °C or below

Exendin-3 is a member of the glucagon family that has secretin-like biological activity when binding to the exendin receptor.

Publications

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders