Calcitonin, human, cyclic

Product Number: 231-25

$158.00$602.00

$158.00
$602.00
SKU: 231-25 Category: Tag:

CAS Number: 21215-62-3
Molecular Weight: 3417.6
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 [Cys1-Cys7]
Sequence (1-letter): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2
Storage: -20 °C or below

Calcitonin is a peptide hormone which reduces levels of blood calcium (Ca2+) in opposition of the parathyroid hormone (PTH). It is formed by the proteolytic cleavage of a larger prepropeptide and is excreted by parafollicular cells of the thyroid gland. It is not a significant factor in humans for calcium homeostasis unlike other animals.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Calcitonin Gene Peptides

Shopping Cart
Scroll to Top