Beta Amyloid (1-40), rat

Product Number: 642-10

$272.00$3,074.00

$272.00
$406.00
$1,610.00
$3,074.00
SKU: 642-10 Category: Tags: ,

CAS Number: 144409-98-3
Molecular Weight: 4231.14
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Storage: -20 °C or below

Beta Amyloid (1-40), rat is a form of the amyloid β-peptide found in plaques associated with Alzheimer’s disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shopping Cart
Scroll to Top