Beta Amyloid (1-40), rat

Product Number: 642-10

$205
$341
$1,601
$2,914

CAS Number: 144409-98-3
Molecular Weight: 4231.14
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Storage: -20 °C or below

Beta Amyloid (1-40), rat is a form of the amyloid β-peptide found in plaques associated with Alzheimer’s disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity.

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders