Parathyroid Hormone (PTH) (1-34), human

Product Number: 231-40

$158$242

$158
$242
SKU: 231-40 Category: Tag:

CAS Number: 52232-67-4
Molecular Weight: 4115.16
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Sequence (1-letter): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH
Storage: -20 °C or below

Parathyroid Hormone (PTH) (1-34) is a bioactive fragment of the full length Parathyroid Hormone. PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top