Pancreastatin (1-52), human

Product Number: 481-20

$416.00$567.00

$416.00
$567.00
SKU: 481-20 Category: Tag:

Molecular Weight: 5505.57
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Gly-Glu-Ser-Arg-Ser-Glu-Ala-Leu-Ala-Val-Asp-Gly-Ala-Gly-Lys-Pro-Gly-Ala-Glu-Glu-Ala-Gln-Asp-Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2
Sequence (1-letter): GESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2
Storage: -20 °C or below

Pancreastatin (1-52), human is a peptide derived from proteolytic cleavage of Chromogranin A. It is found in the neuroendecrine system and has been reported to regulate glycogen synthesis via glycogen synthase kinase-3 (GSK-3).

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top