Pancreastatin (1-52), human

Product Number: 481-20

$459
$625

Molecular Weight: 5505.57
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Gly-Glu-Ser-Arg-Ser-Glu-Ala-Leu-Ala-Val-Asp-Gly-Ala-Gly-Lys-Pro-Gly-Ala-Glu-Glu-Ala-Gln-Asp-Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2
Sequence (1-letter): GESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2
Storage: -20 °C or below

Pancreastatin (1-52), human is a peptide derived from proteolytic cleavage of Chromogranin A. It is found in the neuroendecrine system and has been reported to regulate glycogen synthesis via glycogen synthase kinase-3 (GSK-3).

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders