Neuropeptide Y (human, rat)

Product Number: 611-26

$95
$175

CAS Number: 90880-35-6
Molecular Weight: 4271.76
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence (1-letter): YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Storage: -20 °C or below
Solubility: water 1 mg/mL

Neuropeptide Y (NPY) is a peptide that is abundant in the central and peripheral nervous system that plays a major role in controlling appetite, blood pressure, cardiac contractility, and intestinal secretion. NPY is a vasonconstrictor that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Inhibition of NPY synthesis regulates food intake and metabolism implicating a role in obesity. This NPY amino acid sequence is homologous for human, rat, rabbit, and guinea pig.

References

1. Tatemoto, K., Carlquist, M. and Mutt, V. (1982) “Neuropeptide Y-a novel brain peptide with structural similarities to peptide YY and pancreatic polypeptide” Nature 296: 659-660.
2. Stephens, T.W. et al. (2002) “The role of neuropeptide Y in the antiobesity action of the obese gene product” Nature 377: 530-532
3.O’Barr, S. and Cooper, N.R. (2000) “The C5a complement activation peptide increases IL-1β and IL-6 release from amyloid-β primed human monocytes: implications for Alzheimer’s disease” J. Neuroimmunol. 109: 87–94.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders