Leumorphin (human) (Preproenkephalin B 226-254)

Product Number: 271-35

$166
$254

Molecular Weight: 3349.65
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OH
Sequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYSGELFDA-OH
Storage: -20 °C or below

Leumorphin is an endogenous opioid peptide which corresponds to the 226-254 fragment of Preproenkephalin B. It is also known as Dynorphin B1-29. Leumorphin is potent and selective κ-opioid receptor agonist.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders