Helodermin [Gln8,9]

Product Number: 740-27

$316.00$466.00

$316.00
$466.00
SKU: 740-27 Category: Tag:

CAS Number: 89468-62-2
Molecular Weight: 3841.14
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2
Sequence (1-letter): HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2
Storage: -20 °C or below

Helodermin [Gln8,9] is structurally similar to vasoactive intestinal polypeptide (VIP) from the venom of the lizard Heloderma suspectum. Helodermin exhibits vasodilatory and antihypertensive activities by increasing intracellular cAMP.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Cardiovascular

Shopping Cart
Scroll to Top