Helodermin [Gln8,9]

Product Number: 740-27

$332
$489

CAS Number: 89468-62-2
Molecular Weight: 3841.14
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2
Sequence (1-letter): HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2
Storage: -20 °C or below

Helodermin [Gln8,9] is structurally similar to vasoactive intestinal polypeptide (VIP) from the venom of the lizard Heloderma suspectum. Helodermin exhibits vasodilatory and antihypertensive activities by increasing intracellular cAMP.

Categories

Peptides

Filter

Cardiovascular

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders