Growth Hormone Releasing Factor (GHRF), mouse

Product Number: 536-10

$309.00$519.00

$309.00
$519.00

Growth Hormone Releasing Factor (GHRF, somatocrinin) is a peptide hormone produced in the arcuate nucleus of the hypothamlus. It binds to the GHRH receptor in the anterior pituitary gland and subsequently stimulates growth hormone secretion.

Molecular Weight: 5029.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH
Sequence (1-letter): HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OH
Storage: -20 °C or below

 

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top