Glucagon-like Peptide-2 (GLP-2) (1-33), rat

Product Number: 471-23

$208.00$358.00

$208.00
$358.00
SKU: 471-23 Category: Tags: ,

CAS Number: 195262-56-7
Molecular Weight: 3793.84
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence (1-letter): HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OH
Storage: -20 °C or below

Glucagon-like peptide-2 (GLP-2, Preproglucagon (126-158)) is a 33 amino acid peptide which is formed by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).  GLP-2 is produced in gut endocrine cells and certain neuronal cells in the central nervous system.  Administration of GLP-2 demos demonstrates cytoprotective and reparative effects in rodent models of intestinal injury. An analog of Glucagon-like peptide-2, Teduglutide, is used as a treatment for short-bowel syndrome by increasing nutrient absorption.

 

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Gastrointestinal, Neuropeptides & Hormones

Shopping Cart
Scroll to Top