Teduglutide / GLP 2 [Gly2], human

Product Number: 471-21

$218.00$396.00

$218.00
$396.00
SKU: 471-21 Category: Tags: ,

CAS Number: 197922-42-2
Molecular Weight: 3749.81
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence (1-letter): HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-OH
Storage: -20 °C or below

Teduglutide is an analog of glucagon-like peptide-2 (GLP-2) in which the Ala at position 2 has been replaced by Gly. It is prescribed under the trade name Gattex to treat short-bowel syndrome.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Gastrointestinal, Neuropeptides & Hormones

Shopping Cart
Scroll to Top