Teduglutide / GLP 2 [Gly2], human

Product Number: 471-21

$152
$263

CAS Number: 197922-42-2
Molecular Weight: 3749.81
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence (1-letter): HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-OH
Storage: -20 °C or below

Teduglutide is an analog of glucagon-like peptide-2 (GLP-2) in which the Ala at position 2 has been replaced by Gly. It is prescribed under the trade name Gattex to treat short-bowel syndrome.

Categories

Peptides

Filter

Gastrointestinal, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders