Exendin 3 (9-39) Fragment

Product Number: 507-81

$256$361

$256
$361

CAS Number: 133514-43-9
Molecular Weight: 3367.69
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence (1-letter): DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage: -20 °C or below

Exendin 3 (9-39) is a truncated form of Exendin 4 that acts as a potent and selective GLP-1 receptor antagonist.

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top