Charybdotoxin

CAS Number: 95751-30-7 Molecular Weight: 4298. [Read More...]

Description
Additional Information

CAS Number: 95751-30-7
Molecular Weight: 4298.92
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH [Cys7-Cys28, Cys13-Cys33, Cys17-35]
Sequence (1-letter): (Glp)FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OH
Storage: -20 °C or below

Charybdotoxin is a potent neurotoxin isolated from the deathstalker scorpion, Leiurus quinquestriatus hebraeus. Charybdotoxin depolarizes peripheral T lymphocytes by binding to Ca2+-activated K+ channels and blocks their mitogen-induced proliferation.

/ 0.3

0.5 mg (429-60) quantity	0.5 mg (429-60)	$924
1 mg (429-60) quantity	1 mg (429-60)	$1,787
0.1 mg (429-60) quantity	0.1 mg (429-60)	$200

Categories	Peptides
Filter	Central Nervous System
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

Charybdotoxin

Angiotensin I [Val5,Asn9], bullfrog

Angiotensin I [Asn1,Val5,Asn9], salmon

Urodilatin

Angiotensin I (1-9), DRVYIHPFH-OH

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Charybdotoxin

Related Products

Angiotensin I [Val5,Asn9], bullfrog

Angiotensin I [Asn1,Val5,Asn9], salmon

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register