Big Endothelin-2 (1-37), human

Product Number: 331-40

$395
$655

CAS Number: 132699-72-0
Molecular Weight: 4184.89
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Gln-Thr-Ala-Pro-Tyr-Gly-Leu-Gly-Asn-Pro-Pro-OH [Cys1-Cys15, Cys3-Cys11]
Sequence (1-letter): CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
Storage: -20 °C or below

Big Endothelin-2 is the precursor to the vasoconstricting peptide Endothelin-2 (ET-2). It is hydrolyzed by endothelin converting enzyme (ECE).

Categories

Peptides

Filter

Cardiovascular, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders