Agatoxin IVa

Product Number: 429-15

$1,319
$2,408

CAS Number: 145017-83-0
Molecular Weight: 5206.5
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH [Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, Cys 27-Cys34]
Sequence (1-letter): KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH
Storage: -20 °C or below

Agatoxin IVa is a toxic peptide found in the venom of the funnel web spider, Agelenopsis aptera. Agatoxin IVa is a selective, potent, blocker of mammalian P-type voltage-dependent calcium channels. It is a potent and fast-acting neurotoxin.

Categories

Peptides

Filter

Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders