Agatoxin IVa

Product Number: 429-15

$1,196.00$2,184.00

$1,196.00
$2,184.00
SKU: 429-15 Category: Tag:

CAS Number: 145017-83-0
Molecular Weight: 5206.5
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH [Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, Cys 27-Cys34]
Sequence (1-letter): KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH
Storage: -20 °C or below

Agatoxin IVa is a toxic peptide found in the venom of the funnel web spider, Agelenopsis aptera. Agatoxin IVa is a selective, potent, blocker of mammalian P-type voltage-dependent calcium channels. It is a potent and fast-acting neurotoxin.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Central Nervous System

Shopping Cart
Scroll to Top