ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Product Number: 111-45

$172.00$695.00

$172.00
$695.00
SKU: 111-45 Category: Tag:

CAS Number: 68563-24-6
Molecular Weight: 3656.92
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
Sequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH
Storage: -20 °C or below

ACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.

We are currently moving all Documentation links to this Tab we appreciate your patience. Please feel free to contact us if you have any questions or concerns.

Categories

Peptides

Filter

Neuropeptides & Hormones

Scroll to Top