ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Product Number: 111-45

$190
$767

CAS Number: 68563-24-6
Molecular Weight: 3656.92
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
Sequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH
Storage: -20 °C or below

ACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders