Molecular Weight: 3926.89
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Tyr-OH
Sequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITDY-OH
Storage: -20 °C or below
Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. This analog of GLP-2 with a C-terminal Tyr can be iodinated with 125I and used as a tracer.

![471-19 GLP 2 [Tyr34] (1-34), human - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/471-19.jpg)