Molecular Weight: 3328.73
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2
Sequence (1-letter): SNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
Storage: -20 °C or below
Calcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms. Calcitonin, salmon [Des-Cys1] is an analog in which the N-terminal Cys has been replaced with Ser.

![237-34 Calcitonin, salmon [Des-Cys1] - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/237-34.jpg)