Urotensin I, suckerfish

Product Number: 817-30

$214
$324
$1,295

CAS Number: 83930-33-0
Molecular Weight: 4866.46
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
Storage: -20 °C or below

Urotensin I, suckerfish, is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors.

Publication

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders