Urotensin I, carp

Product Number: 817-40

$214
$324
$1,295

Molecular Weight: 4866.44
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Asn-Glu-Asn-Gln-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARNENQREQAGLNRKYLDEV-NH2
Storage: -20 °C or below

Urotensin I, carp, is a peptide ligand for the corticotrophin-releasing factor (CRF) receptor. It is used to study its immunoregulatory activities in fish.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders