Parathyroid Hormone (PTH) (2-34), human

Product Number: 231-43

$204
$309

CAS Number: 247902-18-7
Molecular Weight: 4028.13
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Sequence (1-letter): VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH
Storage: -20 °C or below

Parathyroid Hormone (PTH) regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium. Measuring serum or plasma PTH levels is important for patients in chronic renal failure. Synthetic N-terminal truncated PTH peptides [e.g. PTH(2–34), PTH(3–34) and PTH(7–84)] do not cross‐react with the detection antibodies used in second‐generation PTH assays.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Room Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders