Pancreatic polypeptide bovine

Product Number: 474-21

$174
$261

Molecular Weight: 4246.08
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Trp-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Sequence (1-letter): APLEPEYPGDNATPEQMAQWAAELRRYINMLTRPRY-NH2
Storage: -20 °C or below

Pancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes, water, and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders