Molecular Weight: 4246.08
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Trp-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Sequence (1-letter): APLEPEYPGDNATPEQMAQWAAELRRYINMLTRPRY-NH2
Storage: -20 °C or below
Pancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes, water, and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.
![Angiotensin I [Asn1,Val5,Asn9], salmon - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-40-e1574455713389.jpg)
![Angiotensin I [Asn1,Val5], goosefish - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-39.jpg)
![Angiotensin I [Val5,Asn9], bullfrog](https://www.echelon-inc.com/wp-content/uploads/2019/11/137-36-e1574459651494.jpg)