Pancreatic polypeptide bovine

Molecular Weight: 4246. [Read More...]

Description
Additional Information

Molecular Weight: 4246.08
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Trp-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Sequence (1-letter): APLEPEYPGDNATPEQMAQWAAELRRYINMLTRPRY-NH2
Storage: -20 °C or below

Pancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes, water, and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.

Categories	Peptides
Filter	Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (474-21) quantity	0.5 mg (474-21)	$194
1 mg (474-21) quantity	1 mg (474-21)	$291

Pancreatic polypeptide bovine

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Pancreatic polypeptide bovine

Related Products

Angiotensin I (1-9), DRVYIHPFH-OH

Angiotensin I [Asn1,Val5], goosefish

Angiotensin I [Asn1,Val5,Asn9], salmon

Angiotensin II-[Sar1]

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register