Pancreatic Polypeptide, avian

Product Number: 478-40

$150.00$278.00

$150.00
$278.00
SKU: 478-40 Category:

Molecular Weight: 4235.09
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asp-Ala-Pro-Val-Glu-Asp-Leu-Ile-Arg-Phe-Tyr-Asp-Asn-Leu-Gln-Gln-Tyr-Leu-Asn-Val-Val-Thr-Arg-His-Arg-Tyr-NH2
Sequence (1-letter): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2
Storage: -20 °C or below

Pancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes, water, and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Shopping Cart
Scroll to Top