Pancreatic Polypeptide, avian

Product Number: 478-40

$158
$292

Molecular Weight: 4235.09
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asp-Ala-Pro-Val-Glu-Asp-Leu-Ile-Arg-Phe-Tyr-Asp-Asn-Leu-Gln-Gln-Tyr-Leu-Asn-Val-Val-Thr-Arg-His-Arg-Tyr-NH2
Sequence (1-letter): GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2
Storage: -20 °C or below

Pancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes, water, and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.

Categories

Peptides

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders