PACAP (1-27), ovine, human

Product Number: 350-37

$242.00$399.00

$242.00
$399.00
SKU: 350-37 Category: Tag:

CAS Number: 127317-03-7
Molecular Weight: 3145.66
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Sequence (1-letter): HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Storage: -20 °C or below

Pituitary adenylate cyclase-activating polypeptide (PACAP) stimulates adenylate cyclase and increases cAMP levels in cells. It is primarily expressed in nervous tissues and has high homology to vasoactive intestinal peptide (VIP). PACAP exists as 38- or 27-amino acid forms though the 1-38 form is predominant. PACAP binds to PAC1-R, VPAC1-R, and VPAC2-R receptors. PACAP functions as a neurotransmitter and neuromodulator.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top