Oxyntomodulin (Glucagon-37)

Product Number: 471-33

$379
$625
$4,964

CAS Number: 74870-06-7
Molecular Weight: 4419.17
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
Sequence (1-letter): HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH
Storage: -20 °C or below

Oxyntomodulin, aka Glucagon-37, is a potent inhibitor of gastric acid secretion and pancreatic enzyme secretion. Oxyntomodulin injected directly into the hypothalamic paraventricular nucleus has been show to inhibit food intake in fasted and nonfasted animals in a potent and sustained manner.

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders