Oxyntomodulin (Glucagon-37)

Product Number: 471-33

$344.00$4,503.00

$344.00
$567.00
$4,503.00

CAS Number: 74870-06-7
Molecular Weight: 4419.17
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
Sequence (1-letter): HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH
Storage: -20 °C or below

Oxyntomodulin, aka Glucagon-37, is a potent inhibitor of gastric acid secretion and pancreatic enzyme secretion. Oxyntomodulin injected directly into the hypothalamic paraventricular nucleus has been show to inhibit food intake in fasted and nonfasted animals in a potent and sustained manner.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top