Metastin, KISS-1 (68-121)

Product Number: 548-25

$361.00$557.00

$361.00
$557.00
SKU: 548-25 Category: Tag:

CAS Number: 374683-24-6
Molecular Weight: 5857.53
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
Sequence (1-letter): GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Storage: -20 °C or below

Metastin, also known as Kisspeptin-54, is a potent endogenous ligand of the kisspeptin receptor GPR54 (KISS1R). It has various functions including increasing the release of aldosterone and GnRH and can act as a tumor suppressor by inhibiting chemotaxis, invasion and metastasis.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top