CAS Number: 374683-24-6
Molecular Weight: 5857.53
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
Sequence (1-letter): GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Storage: -20 °C or below
Metastin, also known as Kisspeptin-54, is a potent endogenous ligand of the kisspeptin receptor GPR54 (KISS1R). It has various functions including increasing the release of aldosterone and GnRH and can act as a tumor suppressor by inhibiting chemotaxis, invasion and metastasis.