Growth Hormone Releasing Factor (GRF) (1-44), porcine

Product Number: 534-29

$279$437

$279
$437

CAS Number: 88384-73-0
Molecular Weight: 5105.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2
Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2
Storage: -20 °C or below

Growth Hormone Releasing Factor (GRF) (1-44), is a 44-aminoacid peptide hormone released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. This is the porcine form.

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top