Growth Hormone Releasing Factor (GRF) (1-40), human

Product Number: 531-68

$194.00$339.00

$194.00
$339.00

CAS Number: 84069-10-3
Molecular Weight: 4541.32
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-OH
Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA(OH)
Storage: -20 °C or below

Growth Hormone Releasing Factor (GHRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top