GLP 2 [Tyr34] (1-34), human

Product Number: 471-19

$208.00$377.00

$208.00
$377.00
SKU: 471-19 Category: Tags: ,

Molecular Weight: 3926.89
Salt Form: TFA
Purity: >95%
Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Tyr-OH
Sequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITDY-OH
Storage: -20 °C or below

Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. This analog of GLP-2 with a C-terminal Tyr can be iodinated with 125I and used as a tracer.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Gastrointestinal, Neuropeptides & Hormones

Shopping Cart
Scroll to Top