Gastrin Releasing Peptide (GRP), human

Product Number: 471-85

$166.00$264.00

$166.00
$264.00
SKU: 471-85 Category: Tags: ,

CAS Number: 93755-85-2
Molecular Weight: 2857.52
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Sequence (1-letter): VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Storage: -20 °C or below

Gastrin Releasing Peptide, human, is a ligand for the GRP receptor and is expressed in a subtype of peptidergic dorsal root ganglion neurons. GRP stimulates pepsinogen release and has also been identified as a tumor marker in the diagnosis of small-cell lung carcinoma. GRP is the mammalian analog of Bombesin.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Gastrointestinal, Neuropeptides & Hormones

Shopping Cart
Scroll to Top