Galanin, porcine

Product Number: 471-25

$309.00$466.00

$309.00
$466.00
SKU: 471-25 Category: Tag:

CAS Number: 88813-36-9
Molecular Weight: 3208.63
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2
Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
Storage: -20 °C or below

Galanin is a neuropeptide first isolated from the porcine small intestine. It has a variety of biologic effects in the digestive system via the GAL1-3 receptors, including inhibiting the secretion of somatostatin, insulin, and glucose.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top