Exendin-4

Product Number: 507-77

$222.00$380.00

$222.00
$380.00

CAS Number: 141758-74-9
Molecular Weight: 4184.04
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence (1-letter): HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage: -20 °C or below

Exendin-4 is an incretin mimetic peptide and  an analog of glucagon-like peptide 1 (GLP-1). The mimetic activity of Exendin-4 controls insulin secretion in a glucose-dependent manner.

Publications

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top