Corticotropin Releasing Factor (CRF) [Tyr0], ovine

Product Number: 352-37

$355
$585

Molecular Weight: 4830.57
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence (1-letter): YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Storage: -20 °C or below

Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis. CRF [Tyr0] has an N-terminal Tyr added which can be radiolabeled with I-125.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders