Corticotropin Releasing Factor (CRF), ovine

Product Number: 352-26

$235$399

$235
$399
SKU: 352-26 Category: Tag:

CAS Number: 79804-71-0
Molecular Weight: 4667.51
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Storage: -20 °C or below

Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top