Corticotropin Releasing Factor (CRF), bovine

Product Number: 353-26

$166
$299

CAS Number: 92307-52-3
Molecular Weight: 4697.34
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
Storage: -20 °C or below

Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis.

Categories

Peptides

Filter

Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders