Charybdotoxin

Product Number: 429-60

$774.00$1,497.00

$774.00
$1,497.00
SKU: 429-60 Category: Tag:

CAS Number: 95751-30-7
Molecular Weight: 4298.92
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH [Cys7-Cys28, Cys13-Cys33, Cys17-35]
Sequence (1-letter): (Glp)FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OH
Storage: -20 °C or below

Charybdotoxin is a potent neurotoxin isolated from the deathstalker scorpion, Leiurus quinquestriatus hebraeus. Charybdotoxin depolarizes peripheral T lymphocytes by binding to Ca2+-activated K+ channels and blocks their mitogen-induced proliferation.

 

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Central Nervous System

Shopping Cart
Scroll to Top