Cecropin B

Product Number: 893-50

$214
$324

CAS Number: 80451-05-4
Molecular Weight: 3832.29
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Sequence (1-letter): KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Storage: -20 °C or below

Cecropin B is a cationic antimicrobial peptide isolated from the hemolyph of Hyalophora cecropia (cecropia moth). Cecropins are part of the insect innate immunity system and act against primarily Gram-negative bacteria.

Categories

Peptides

Filter

Antimicrobial Peptide

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders