Cecropin B

Product Number: 893-50

$194.00$294.00

$194.00
$294.00
SKU: 893-50 Category: Tag:

CAS Number: 80451-05-4
Molecular Weight: 3832.29
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Sequence (1-letter): KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Storage: -20 °C or below

Cecropin B is a cationic antimicrobial peptide isolated from the hemolyph of Hyalophora cecropia (cecropia moth). Cecropins are part of the insect innate immunity system and act against primarily Gram-negative bacteria.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Antimicrobial Peptide

Shopping Cart
Scroll to Top