Brain Natriuretic Peptide (BNP) (1-32), human / Brain ANP (1-32), human

Product Number: 152-52

$222.00$373.00

$222.00
$373.00
SKU: 152-52 Category: Tags: ,

CAS Number: 124584-08-3
Molecular Weight: 3464.10
Salt Form: TFA
Purity: >90%
Sequence (3-letter): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26]
Sequence (1-letter): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH
Storage: -20 °C or below

Brain Natriuretic Peptide (BNP) (1-32) is a bioactive fragment of the 108-aa inactive precursor pro-BNP. Like all natriuretic peptides, BNP (1-32) has an important role in cardiac homeostasis. It binds to the NPR-A receptor and its actions include vasodilation and inhibition of the renal-angiotensin-aldosterone sysntem (RAAS).

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Cardiovascular, Neuropeptides & Hormones

Shopping Cart
Scroll to Top