Big Endothelin 1 (1-39), rat

Product Number: 335-50

$376.00$624.00

$376.00
$624.00
SKU: 335-50 Category: Tags: ,

CAS Number: 135842-15-8
Molecular Weight: 4390.05
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH [Cys1-Cys15, Cys3-Cys11]
Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS-OH
Storage: -20 °C or below

Big Endothelin (1-39) is the precursor to the rat vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Cardiovascular, Neuropeptides & Hormones

Shopping Cart
Scroll to Top