Big Endothelin 1 (1-39), porcine

Product Number: 334-10

$395
$655

CAS Number: 120796-99-8
Molecular Weight: 4385.03
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH [Cys1-Cys15, Cys3-Cys11]
Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS-OH
Storage: -20 °C or below

Big Endothelin (1-39) is the precursor to the porcine vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders