Beta Amyloid [Glp3] (3-42), human

Product Number: 641-16

$489

CAS Number: 183449-57-2
Molecular Weight: 4309.94
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glp-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Sequence (1-letter): (Glp)FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Storage: -20 °C or below
Alternate Name: (Pyr³)-Amyloid β-Protein (3-42)

Beta Amyloid [Glp3] (3-42) is a major component of of β-amyloid protein found in the brains of patients with Alzheimer′s disease and Down′s syndrome. It is suggested to accumulate in the brain and trigger beta amyloid plaque deposits.

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders