Beta Amyloid [Gln11] (1-40), human

Product Number: 641-11

$285
$869

Molecular Weight: 4326.19
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(OH)
Storage: -20 °C or below

Beta amyloid (1-40), along with beta amyloid (1-42), is one of the two main variants of the amyloid β peptide involved in Alzheimer’s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer’s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Gln instead of Glu at position 11.

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders