CAS Number: 144410-00-4
Molecular Weight: 4326.19
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV-OH
Storage: -20 °C or below

Beta Amyloid [Gln 22] (1-40), human
Product Number: 640-20
$294.00 – $416.00
We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com
Categories | Peptides |
---|---|
Filter | Alzheimer's, Central Nervous System |