Beta Amyloid [Gln 22] (1-40), human

Product Number: 640-20

$309$437

$309
$437
SKU: 640-20 Category: Tags: ,

CAS Number: 144410-00-4
Molecular Weight: 4326.19
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV-OH
Storage: -20 °C or below

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shopping Cart
Scroll to Top