Adrenomedullin (22-52), human

Product Number: 331-82

$236
$379

CAS Number: 159899-65-7
Molecular Weight: 3573.88
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Sequence (1-letter): TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Storage: -20 °C or below

Adrenomedullin (22-52) is an andrenomedullin (ADM) antagonist which blocks production of cAMP. In addition, it antagonizes the calcitonin generelated peptide (CGRP) receptor.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders